PDB entry 1wq9

View 1wq9 on RCSB PDB site
Description: Crystal structure of VR-1, a VEGF-F from a snake venom
Class: toxin
Keywords: Snake venom, Vascular endothelial growth factor, VEGF, VEGF-F
Deposited on 2004-09-24, released 2004-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 2004-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vascular endothelial growth factor
    Species: Daboia russelli russelli
    Domains in SCOP 1.75: d1wq9a_
  • Chain 'B':
    Compound: vascular endothelial growth factor
    Species: Daboia russelli russelli
    Domains in SCOP 1.75: d1wq9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wq9A (A:)
    evrpfldvyqrsacqtretlvsilqehpdeisdifrpscvavlrcsgcctdesmkctpvg
    khtadiqimrmnprthsskmevmkfmehtacecrpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wq9B (B:)
    evrpfldvyqrsacqtretlvsilqehpdeisdifrpscvavlrcsgcctdesmkctpvg
    khtadiqimrmnprthsskmevmkfmehtacecrpa