SCOPe 2.01: Structural Classification of Proteins

PDB entry 1wq8

View 1wq8 on RCSB PDB site
Description: Crystal structure of Vammin, a VEGF-F from a snake venom
Class: toxin
Keywords: snake venom, Vascular endothelial growth factor, VEGF, VEGF-F, TOXIN
Deposited on 2004-09-23, released 2004-12-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Vascular endothelial growth factor toxin
Species: Vipera aspis aspis [TaxId:194601]
Database cross-references and differences (RAF-indexed):
- Uniprot P83942 (1-End)
Domains in SCOPe 2.01: d1wq8a_
Heterogens: TRS, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1wq8A (A:)
evrpflevhersacqaretlvpilqeypdeisdifrpscvavlrcsgcctdeslkctpvg
khtvdiqimrvnprtqsskmevmkftehtacecrprrkqgepdgpkekpr

Sequence, based on observed residues (ATOM records): (download)

>1wq8A (A:)
evrpflevhersacqaretlvpilqeypdeisdifrpscvavlrcsgcctdeslkctpvg
khtvdiqimrvnprtqsskmevmkftehtacecrprrkqg