PDB entry 1wq4

View 1wq4 on RCSB PDB site
Description: Escherichia coli tyrosyl-tRNA synthetase mutant complexed with L-tyrosine
Class: ligase
Keywords: LIGASE, AMINOACYL-TRNA SYNTHETASE, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-09-20, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00951 (0-320)
      • engineered (35)
      • engineered (193)
    Domains in SCOPe 2.07: d1wq4a_
  • Heterogens: TYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wq4A (A:)
    assnlikqlqerglvaqvtdeealaerlaqgpialvcgfdptadslhlghlvpllclkrf
    qqaghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgensa
    iaannydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqgy
    dfaclnkqygvvlciggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkteg
    gavwldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraqy
    vlaeqvtrlvhgeeglqaakr