PDB entry 1wq3

View 1wq3 on RCSB PDB site
Description: Escherichia coli tyrosyl-tRNA synthetase mutant complexed with 3-iodo-L-tyrosine
Class: ligase
Keywords: Ligase, aminoacyl-TRNA sybthetase, protein-3-Iodotyrosine complex, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-09-20, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: ESCHERICHIA COLI [TaxId:316407]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00951 (0-321)
      • engineered (36)
      • engineered (194)
    Domains in SCOPe 2.07: d1wq3a_
  • Heterogens: IYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wq3A (A:)
    massnlikqlqerglvaqvtdeealaerlaqgpialvcgfdptadslhlghlvpllclkr
    fqqaghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgens
    aiaannydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqg
    ydfaclnkqygvvlciggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkte
    ggavwldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraq
    yvlaeqvtrlvhgeeglqaakr