PDB entry 1wox

View 1wox on RCSB PDB site
Description: Crystal structure of heme oxygenase-2 from Synechocystis sp. PCC 6803 in complex with heme and NO
Class: oxidoreductase
Keywords: HOMO-DIMER, NO-bound heme complex, OXIDOREDUCTASE
Deposited on 2004-08-26, released 2005-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.211
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 2
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1woxa_
  • Chain 'B':
    Compound: Heme oxygenase 2
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1woxb_
  • Heterogens: HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1woxA (A:)
    mtnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhr
    dneiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepelli
    ahcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlns
    lpldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearsta
    ghpitlmvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1woxA (A:)
    tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
    neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
    hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
    pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgsteghpitl
    mvge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1woxB (B:)
    mtnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhr
    dneiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepelli
    ahcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlns
    lpldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearsta
    ghpitlmvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1woxB (B:)
    tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
    neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
    hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
    pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgsteghpitl
    mvge