PDB entry 1wov

View 1wov on RCSB PDB site
Description: Crystal strucure of heme oxygenase-2 from Synechocystis sp. PCC 6803 in complex with heme
Class: oxidoreductase
Keywords: homo dimer, oxidoreductase
Deposited on 2004-08-26, released 2005-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 2
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wova1
  • Chain 'B':
    Compound: Heme oxygenase 2
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wovb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wovA (A:)
    mtnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhr
    dneiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepelli
    ahcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlns
    lpldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearsta
    ghpitlmvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wovA (A:)
    tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
    neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
    hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
    pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgsteghpitl
    mvge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wovB (B:)
    mtnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhr
    dneiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepelli
    ahcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlns
    lpldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearsta
    ghpitlmvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wovB (B:)
    tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
    neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
    hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
    pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstepitlmv
    ge