PDB entry 1wno

View 1wno on RCSB PDB site
Description: Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407
Class: hydrolase
Keywords: eight-stranded beta/alpha-barrel, hydrolase
Deposited on 2004-08-07, released 2005-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q870C0 (0-End)
      • conflict (48)
    Domains in SCOPe 2.06: d1wnoa1, d1wnoa2
  • Chain 'B':
    Compound: chitinase
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q870C0 (0-End)
      • conflict (48)
    Domains in SCOPe 2.06: d1wnob1, d1wnob2
  • Heterogens: NDG, NAG, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnoA (A:)
    assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
    ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
    tavkllqdlgfdgldidweypendqqandfvlllrevrtaldsysaanaggqhflltvas
    pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
    ldlyraggvpankivlgmplygrsfantdgpgkpyngvgqgswengvwdykalpqagate
    hvlpdimasysydatnkflisydnpqvanlksgyikslglggamwwdsssdktgsdslit
    tvvnalggtgvfeqsqneldypvsqydnlrngmqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnoA (A:)
    assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
    ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
    tavkllqdlgfdgldidweypendqqandfvlllrevrtaldsysaanaggqhflltvas
    pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
    ldlyraggvpankivlgmplygrsfantdgpgkpyngvgqgswengvwdykalpqagate
    hvlpdimasysydatnkflisydnpqvanlksgyikslglggamwwdsssdktgsdslit
    tvvnalggtgvfeqsqneldypvsqydnlrngmq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wnoB (B:)
    assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
    ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
    tavkllqdlgfdgldidweypendqqandfvlllrevrtaldsysaanaggqhflltvas
    pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
    ldlyraggvpankivlgmplygrsfantdgpgkpyngvgqgswengvwdykalpqagate
    hvlpdimasysydatnkflisydnpqvanlksgyikslglggamwwdsssdktgsdslit
    tvvnalggtgvfeqsqneldypvsqydnlrngmqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnoB (B:)
    assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
    ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
    tavkllqdlgfdgldidweypendqqandfvlllrevrtaldsysaanaggqhflltvas
    pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
    ldlyraggvpankivlgmplygrsfantdgpgkpyngvgqgswengvwdykalpqagate
    hvlpdimasysydatnkflisydnpqvanlksgyikslglggamwwdsssdktgsdslit
    tvvnalggtgvfeqsqneldypvsqydnlrngmq