PDB entry 1wm6

View 1wm6 on RCSB PDB site
Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Thioesterase, Hot dog fold, Phenylacetic acid degradation, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-07-04, released 2005-07-05
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm6a1
  • Chain 'B':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm6b1
  • Chain 'C':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm6c1
  • Chain 'D':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm6d1
  • Chain 'E':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm6e1
  • Chain 'F':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm6f1
  • Chain 'G':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm6g1
  • Chain 'H':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm6h1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wm6A (A:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm6A (A:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wm6B (B:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm6B (B:)
    rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
    valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wm6C (C:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm6C (C:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wm6D (D:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm6D (D:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wm6E (E:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm6E (E:)
    dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
    alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wm6F (F:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm6F (F:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1wm6G (G:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm6G (G:)
    dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
    alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wm6H (H:)
    mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
    avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
    gddvpagtgnlaprea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm6H (H:)
    rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
    valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl