PDB entry 1wm0

View 1wm0 on RCSB PDB site
Description: PPARgamma in complex with a 2-BABA compound
Class: transcription/signaling protein
Keywords: three-layer helical domain, TRANSCRIPTION/SIGNALING PROTEIN COMPLEX
Deposited on 2004-07-01, released 2004-09-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Peroxisome proliferator activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96J12 (18-291)
      • expression tag (14-17)
    Domains in SCOPe 2.01: d1wm0x_
  • Chain 'Y':
    Compound: 14-mer from Nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PLB

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1wm0X (X:)
    gsshhhhhhsgsgtiegrlnpesadlralakhlydsyiksfpltkakarailtgkttdks
    pfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipg
    fvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfme
    pkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnh
    pessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm0X (X:)
    iegrlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhiskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly
    

  • Chain 'Y':
    No sequence available.