PDB entry 1wlu

View 1wlu on RCSB PDB site
Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Thioesterase, Hot dog fold, Phenylacetic acid degradation, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-06-29, released 2005-07-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.188
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phenylacetic acid degradation protein paaI
  Species: Thermus thermophilus HB8 [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SJP3 (0-End)
  Domains in SCOPe 2.01: d1wlua_
• Heterogens: CL, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1wluA (A:)
  mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
  avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggd
  gddvpagtgnlaprea
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1wluA (A:)
  mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
  avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl