PDB entry 1wku

View 1wku on RCSB PDB site
Description: High resolution structure of the human alpha-actinin isoform 3
Class: Contractile Protein
Keywords: Calponin homology domain, Actin binding domain, Contractile Protein
Deposited on 2004-06-08, released 2005-05-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.182
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-actinin 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACTN3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1wkua1, d1wkua2
  • Chain 'B':
    Compound: Alpha-actinin 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACTN3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1wkub1, d1wkub2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wkuA (A:)
    hhhhhhymeqeedwdrdllldpawekqqrktftawcnshlrkagtqienieedfrnglkl
    mlllevisgerlprpdkgkmrfhkianvnkaldfiaskgvklvsigaeeivdgnlkmtlg
    miwtiilrfaiqdisveetsakeglllwcqrktapyrnvnvqnfhtswkdglalcalihr
    hrpdlidyaklrkddpignlntafevaekyldipkmldaedivntpkpdekaimtyvscf
    yhafagaeqaetaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkuA (A:)
    awekqqrktftawcnshlrkagtqienieedfrnglklmlllevisgerlprpdkgkmrf
    hkianvnkaldfiaskgvklvsigaeeivdgnlkmtlgmiwtiilrfaiqdisveetsak
    eglllwcqrktapyrnvnvqnfhtswkdglalcalihrhrpdlidyaklrkddpignlnt
    afevaekyldipkmldaedivntpkpdekaimtyvscfyhafaga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wkuB (B:)
    hhhhhhymeqeedwdrdllldpawekqqrktftawcnshlrkagtqienieedfrnglkl
    mlllevisgerlprpdkgkmrfhkianvnkaldfiaskgvklvsigaeeivdgnlkmtlg
    miwtiilrfaiqdisveetsakeglllwcqrktapyrnvnvqnfhtswkdglalcalihr
    hrpdlidyaklrkddpignlntafevaekyldipkmldaedivntpkpdekaimtyvscf
    yhafagaeqaetaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wkuB (B:)
    awekqqrktftawcnshlrkagtqienieedfrnglklmlllevisgerlprpdkgkmrf
    hkianvnkaldfiaskgvklvsigaeeivdgnlkmtlgmiwtiilrfaiqdisveetsak
    eglllwcqrktapyrnvnvqnfhtswkdglalcalihrhrpdlidyaklrkddpignlnt
    afevaekyldipkmldaedivntpkpdekaimtyvscfyhafagaeq