PDB entry 1wju

View 1wju on RCSB PDB site
Description: Solution structure of N-terminal ubiquitin-like domain of human NEDD8 ultimate buster-1
Class: protein binding
Keywords: Ubiquitin-like domain, NEDD8 ultimate buster-1, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NEDD8 ultimate buster-1
  Species: Homo sapiens [TaxId:9606]
  Gene: IMS cDNA SYN05355
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y5A7 (7-93)
    • cloning artifact (0-6)
    • cloning artifact (94-99)
  Domains in SCOPe 2.05: d1wjua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjuA (A:)
  gssgssgdnyrttgiatievflpprlkkdrknlletrlhitgrelrskiaetfglqenyi
  kivinkkqlqlgktleeqgvahnvkamvlelkqssgpssg