PDB entry 1wjn

View 1wjn on RCSB PDB site
Description: Solution structure of the C-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
Class: chaperone
Keywords: ubiquitin-like domain, progressive motor neuropathy, tubulin-folding protein TBCE, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CHAPERONE
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tubulin-folding protein TBCE
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2610206D02
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8CIV8 (7-90)
    • cloning artifact (0-6)
    • cloning artifact (91-96)
  Domains in SCOPe 2.05: d1wjna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjnA (A:)
  gssgssgqlltlkikcsnqperqilekqlpdsmtvqkvkgllsrllkvpvselllsyess
  kmpgreielendlqplqfysvengdcllvrwsgpssg