PDB entry 1wj4

View 1wj4 on RCSB PDB site
Description: Solution structure of the UBX domain of KIAA0794 protein
Class: Structural genomics, unknown function
Keywords: UBX domain, beta-Grasp fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA0794 protein
    Species: HOMO SAPIENS
    Gene: KAZUSA cDNA hk06006
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94888 (7-117)
      • cloning artifact (0-6)
      • cloning artifact (118-123)
    Domains in SCOP 1.73: d1wj4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wj4A (A:)
    gssgssgtatnhqglpavdseilemppekadgvvegidvngpkaqlmlrypdgkreqitl
    peqakllalvkhvqskgypnerfelltnfprrklshldyditlqeaglcpqetvfvqesg
    pssg