PDB entry 1wiv

View 1wiv on RCSB PDB site
Description: solution structure of RSGI RUH-023, a UBA domain from Arabidopsis cDNA
Class: Structural genomics, unknown function
Keywords: ubiquitin associated domain, UBA domain, three helix bundle, ubiquitin specific protease 14, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-specific protease 14
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: K10D20
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8L6Y1 (7-66)
    • cloning artifact (0-6)
    • cloning artifact (67-72)
  Domains in SCOPe 2.06: d1wiva1, d1wiva2, d1wiva3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wivA (A:)
  gssgssgllshmddpdidapishqtsdidqssvdtllsfgfaedvarkalkasggdieka
  tdwvfnnsgpssg