PDB entry 1wit

View 1wit on RCSB PDB site
Description: twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, minimized average structure
Deposited on 1996-06-23, released 1996-12-23
The last revision prior to the SCOP 1.57 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1wit__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wit_ (-)
    lkpkiltasrkikikagfthnlevdfigapdptatwtvgdsgaalapellvdakssttsi
    ffpsakradsgnyklkvknelgedeaifevivq