PDB entry 1wip

View 1wip on RCSB PDB site
Description: structure of T-cell surface glycoprotein cd4, monoclinic crystal form
Class: glycoprotein
Keywords: immunoglobulin fold, transmembrane, glycoprotein, T-cell, MHC lipoprotein, polymorphism
Deposited on 1996-12-18, released 1997-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.452
AEROSPACI score: -0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wipA (A:)
    kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
    lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
    ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvlafq
    kassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsvkr
    vtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvvmratqlqkn
    ltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsgqvllesnik
    vlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wipB (B:)
    kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
    lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
    ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvlafq
    kassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsvkr
    vtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvvmratqlqkn
    ltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsgqvllesnik
    vlp