PDB entry 1wih

View 1wih on RCSB PDB site
Description: Solution structure of RSGI RUH-021, a domain II of ribosome recycling factor from mouse cDNA
Class: Structural genomics, unknown function
Keywords: ribosome recycling factor, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial ribosome recycling factor
    Species: MUS MUSCULUS
    Gene: RIKEN cDNA 2310061P21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D6S7 (7-77)
      • cloning artifact (0-6)
      • cloning artifact (78-83)
    Domains in SCOP 1.75: d1wiha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wihA (A:)
    gssgssgldhitvvtadgkvalnqigqismkspqvilvnmasfpectaaaikairesgmn
    lnpevegtlirvpipkvtsgpssg