PDB entry 1wib

View 1wib on RCSB PDB site
Description: Solution structure of the N-terminal domain from mouse hypothetical protein BAB22488
Class: ribosome
Keywords: N-terminal domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RIBOSOME
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 60S ribosomal protein L12
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 0710001M22
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35979 (6-84)
    • cloning artifact (0-6)
    • cloning artifact (86-89)
    • cloning artifact (91)
  Domains in SCOPe 2.01: d1wiba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wibA (A:)
  gssgssgppkfdpnevkvvylrctggevgatsalapkigplglspkkvgddiakatgdwk
  glritvkltiqnrqaqievvpsasalsgpssg