PDB entry 1wi8

View 1wi8 on RCSB PDB site
Description: Solution structure of the RNA binding domain of eukaryotic initiation factor 4B
Class: biosynthetic protein
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, BIOSYNTHETIC PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: RIKEN cDNA adSE02039
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23588 (7-97)
      • cloning artifact (0-6)
      • engineered (83)
      • cloning artifact (98-103)
    Domains in SCOPe 2.05: d1wi8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wi8A (A:)
    gssgssgsrlpksppytaflgnlpydvteesikeffrglnisavrlprepsnperlkgfg
    yaefedldsllsalslneeslgnkrirvdvadqaqdkdsgpssg