PDB entry 1wi6

View 1wi6 on RCSB PDB site
Description: Solution structure of the RNA binding domain from mouse hypothetical protein BAB23670
Class: structural genomics, unknown function
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2005-06-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein (RIKEN cDNA 1300006N24)
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1300006N24
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C3Z1 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)
    Domains in SCOPe 2.05: d1wi6a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wi6A (A:)
    gssgssgilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaaintf
    hqsrlrerelsvqlqptdallcsgpssg