PDB entry 1wi0

View 1wi0 on RCSB PDB site
Description: Solution structure of the PB1 domain of mouse mitogen activated protein kinase kinase 5 (MAP2K5)
Class: transferase
Keywords: PB1 domain, protein-protein interaction site, cytoplasmic signalling, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, transferase
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen activated protein kinase kinase 5
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA A230106F01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WVS7 (7-106)
      • cloning artifact (0-6)
      • cloning artifact (107-112)
    Domains in SCOPe 2.08: d1wi0a1, d1wi0a2, d1wi0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wi0A (A:)
    gssgssgpfcamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttaf
    eyededgdritvrsdeemkamlsyyystvmeqqvngqlieplqifprsgpssg