PDB entry 1whw

View 1whw on RCSB PDB site
Description: Solution structure of the N-terminal RNA binding domain from hypothetical protein BAB23448
Class: RNA binding protein
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein RIKEN CDNA 1200009A02
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN CDNA 1200009A02
  Database cross-references and differences (RAF-indexed):
  • GB BAB23448 (7-92)
    • cloning artifact (0-6)
    • cloning artifact (93-98)
  Domains in SCOPe 2.06: d1whwa1, d1whwa2, d1whwa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1whwA (A:)
  gssgssgsgrlfvrnlsytsseedleklfsaygplselhypidsltkkpkgfafvtfmfp
  ehavkayaevdgqvfqgrmlhvlpstikkeasqsgpssg