PDB entry 1whv

View 1whv on RCSB PDB site
Description: Solution structure of the RNA binding domain from hypothetical protein BAB23382
Class: hydrolase
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, poly(A)-specific ribonuclease, PARN, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(A)-specific Ribonuclease
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1200003I18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDG3 (7-93)
      • cloning artifact (0-6)
      • cloning artifact (94-99)
    Domains in SCOPe 2.05: d1whva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whvA (A:)
    gssgssggpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpe
    qvqiavntskyaesyriqtyaeyvgkkqkgkqvksgpssg