PDB entry 1whc

View 1whc on RCSB PDB site
Description: Solution Structure of RSGI RUH-027, a UBA domain from Mouse cDNA
Class: structural genomics, unknown function
Keywords: UBA domain, Mus musculus, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UBA/UBX 33.3 kDa protein
    Species: Mus musculus [TaxId:10090]
    Gene: BC006701
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q922Y1 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.03: d1whca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whcA (A:)
    gssgssgaeltalesliemgfprgraekalaltgnqgieaamdwlmeheddpdvdeplsg
    pssg