PDB entry 1wh9

View 1wh9 on RCSB PDB site
Description: Solution structure of the KH domain of human ribosomal protein S3
Class: ribosome
Keywords: KH domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 40S ribosomal protein S3
    Species: HOMO SAPIENS
    Gene: IMS cDNA adKA01519
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23396 (7-85)
      • cloning artifact (0-6)
      • cloning artifact (86-91)
    Domains in SCOP 1.75: d1wh9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wh9A (A:)
    gssgssgfkaelnefltrelaedgysgvevrvtptrteiiilatrtqnvlgekgrrirel
    tavvqkrfgfpegsvelyaekvatrgsgpssg