PDB entry 1wgh

View 1wgh on RCSB PDB site
Description: Solution Structure of Mouse Ubiquitin-like 3 Protein
Class: structural genomics, unknown function
Keywords: Ubiquitin-like 3, HCG-1 protein, Ubiquitin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-like 3
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1500017C14
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Z2M6 (7-109)
    • cloning artifact (0-6)
    • cloning artifact (110-115)
  Domains in SCOPe 2.08: d1wgha1, d1wgha2, d1wgha3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wghA (A:)
  gssgssgmsshvpadminlrlilvsgktkeflfspndsasdiakhvydnwpmdweeeqvs
  spnilrliyqgrflhgnvtlgalklpfgkttvmhlvaretlpepnsqgqrsgpssg