PDB entry 1wgg

View 1wgg on RCSB PDB site
Description: Solution Structure of the N-terminal Ubiquitin-like Domain of Mouse Ubiquitin Specific Protease 14 (USP14)
Class: Hydrolase
Keywords: Ubiquitin specific protease 14, USP14, Ubiquitin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Hydrolase
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Mus musculus [TaxId:10090]
    Gene: REKIN cDNA 2610005K12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JMA1 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.07: d1wgga1, d1wgga2, d1wgga3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wggA (A:)
    gssgssgysvtvkwgkekfegvelntdeppmvfkaqlfaltgvqparqkvmvkggtlkdd
    dwgnikmkngmtvlmmgsadalpeepsaktsgpssg