PDB entry 1wg9

View 1wg9 on RCSB PDB site
Description: Crystal structure of ATP-dependent phosphoenolpyruvate carboxykinase from Thermus thermophilus HB8
Class: transferase
Keywords: phosphoenolpyruvate carboxykinase, adenosine triphosphate, Thermus thermophilus
Deposited on 2004-05-27, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-10-11, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent phosphoenolpyruvate carboxykinase
    Species: Thermus thermophilus
  • Chain 'B':
    Compound: ATP-dependent phosphoenolpyruvate carboxykinase
    Species: Thermus thermophilus
    Domains in SCOPe 2.07: d1wg9b3, d1wg9b4
  • Heterogens: CA, PO4, ATP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wg9B (B:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgekirkhapr
    vylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpq
    ellnpretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wg9B (B:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvpratfsacfgapflpmhpgvyarmlgekirkhaprvylvntgwt
    ggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqellnpretw
    adkeaydqqarklarlfqenfqkyasgvakevaeagprt