PDB entry 1wg1

View 1wg1 on RCSB PDB site
Description: Solution structure of RNA binding domain in BAB13405(homolog EXC-7)
Class: RNA binding protein
Keywords: RBD, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1579 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Riken cDNA 04678
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HCJ3 (7-81)
    • cloning artifact (0-6)
    • cloning artifact (82-87)
  Domains in SCOPe 2.08: d1wg1a1, d1wg1a2, d1wg1a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wg1A (A:)
  gssgssgilvknlpqdsncqevhdllkdydlkycyvdrnkrtafvtllngeqaqnaiqmf
  hqysfrgkdlivqlqptdallcsgpssg