PDB entry 1wg0

View 1wg0 on RCSB PDB site
Description: Structural comparison of Nas6p protein structures in two different crystal forms
Class: protein binding
Keywords: Ankyrin repeats, gankyrin homolog, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-05-27, released 2005-06-07
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.179
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 26S proteasome regulatory subunit p28
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50086 (0-227)
      • his tag (228-242)
    Domains in SCOP 1.73: d1wg0a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wg0A (A:)
    msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskme
    nvnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwf
    evsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfh
    alaeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnvvdklaaalehhh
    hhh