PDB entry 1wfy

View 1wfy on RCSB PDB site
Description: Solution structure of the Ras-binding domain of mouse RGS14
Class: signaling protein
Keywords: Regulators of G-protein signaling, Ras family, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-27, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: regulator of G-protein signaling 14; rap1/rap2 interacting protein
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 0610041O18
  Database cross-references and differences (RAF-indexed):
  • Uniprot P97492 (7-97)
    • cloning artifact (0-6)
    • cloning artifact (98-103)
  Domains in SCOP 1.73: d1wfya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wfyA (A:)
  gssgssgdqevrlenritfqlelvglervvrisakptkrlqealqpilakhglsldqvvl
  hrpgekqpmdlenpvssvasqtlvldtppdakmsearssgpssg