PDB entry 1wfq

View 1wfq on RCSB PDB site
Description: Solution structure of the first cold-shock domain of the human KIAA0885 protein (UNR protein)
Class: RNA binding protein
Keywords: Beta-barrel, translational regulation, RNA chaperone, RNA/DNA binding, QB fold, Greek-key topology, unr protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UNR protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hk07709
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75534 (7-82)
      • cloning artifact (0-6)
      • cloning artifact (83-88)
    Domains in SCOPe 2.08: d1wfqa1, d1wfqa2, d1wfqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wfqA (A:)
gssgssggypngtsaalretgvieklltsygfiqcserqarlffhcsqyngnlqdlkvgd
dvefevssdrrtgkpiavklvkisgpssg