PDB entry 1wfo

View 1wfo on RCSB PDB site
Description: The eighth FN3 domain of human sidekick-2
Class: cell adhesion
Keywords: sidekick-2, fn3, cell adhesion, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-26, released 2005-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sidekick 2
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA fh00815
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q58EX2 (7-123)
    • cloning artifact (0-6)
    • cloning artifact (124-129)
  Domains in SCOPe 2.06: d1wfoa1, d1wfoa2, d1wfoa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wfoA (A:)
  gssgssgrigdgspshppilertlddvpgppmgilfpevrttsvrliwqppaapngiila
  yqithrlntttantatvevlapsarqytatglkpesvylfritaqtrkgwgeaaealvvt
  tekrsgpssg