PDB entry 1wf9

View 1wf9 on RCSB PDB site
Description: Solution structure of a novel beta-grasp fold like domain of Hypothetical protein (Arabidopsis thaliana)
Class: Structural genomics, unknown function
Keywords: Beta-grasp fold like domain, Arabidopsis thaliana, Hypothetical protein, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-26, released 2005-06-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NPL4 family protein
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: RIKEN RAFL09-18-B15
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LYC2 (7-100)
    • cloning artifact (0-6)
    • cloning artifact (101-106)
  Domains in SCOPe 2.05: d1wf9a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wf9A (A:)
  gssgssgtmlrvrsrdglervsvdgphitvsqlktliqdqlqipihnqtlstnrnlllak
  spsdflaftdmadpnlrisslnlahgsmvylayegertirgsgpssg