PDB entry 1wf3

View 1wf3 on RCSB PDB site
Description: Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8
Class: Hydrolase
Keywords: GTP-binding protein, GTPase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, Hydrolase
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.2
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TT1341
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1wf3a1, d1wf3a2
  • Heterogens: MG, GNP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wf3A (A:)
    maektysgfvaivgkpnvgkstllnnllgvkvapisprpqttrkrlrgiltegrrqivfv
    dtpglhkpmdalgefmdqevyealadvnavvwvvdlrhpptpedelvaralkplvgkvpi
    llvgnkldaakypeeamkayhellpeaeprmlsalderqvaelkadllalmpegpffype
    dyaksdqtfgewvaeilreeamkrlwhevpyavatkveevaerengvlyikailyverps
    qkaivigeggrkikeigqatrkqleallgkkvyldlevkvypdwrkdpealrelgyrssv
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf3A (A:)
    ektysgfvaivgkpnvgkstllnnllgvkvapisprpqttrkrlrgiltegrrqivfvdt
    pglhkpmdalgefmdqevyealadvnavvwvvdlrhpptpedelvaralkplvgkvpill
    vgnkldaakypeeamkayhellpeaeprmlsalderqvaelkadllalmpegpffypedy
    aksdqtfgewvaeilreeamkrlwhevpyavatkveevaerengvlyikailyverpsqk
    aivigeggrkikeigqatrkqleallgkkvyldlevkvypdwrkdpealrelgyrs