PDB entry 1wf1

View 1wf1 on RCSB PDB site
Description: Solution structure of RRM domain in RNA-binding protein NP_057951
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, RNA binding protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein Raly
    Species: Homo sapiens [TaxId:9606]
    Gene: HRC04171
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKM9 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)
    Domains in SCOPe 2.04: d1wf1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wf1A (A:)
gssgssgmslklqasnvtnkndpksinsrvfignlntalvkksdvetifskygrvagcsv
hkgyafvqysnerharaavlgengrvlagqtldinmagepkpdrsgpssg