PDB entry 1wf0

View 1wf0 on RCSB PDB site
Description: Solution structure of RRM domain in TAR DNA-binding protein-43
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-25, with a file datestamp of 2004-11-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wf0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wf0A (A:)
    gssgssgvfvgrctgdmtedelreffsqygdvmdvfipkpfrafafvtfaddqiaqslcg
    edliikgisvhisnaepkhnsnsgpssg