PDB entry 1wex

View 1wex on RCSB PDB site
Description: Solution structure of RRM domain in protein BAB28521
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein (riken cdna 2810036l13)
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2810036L13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q921F4 (7-97)
      • cloning artifact (0-6)
      • cloning artifact (98-103)
    Domains in SCOPe 2.05: d1wexa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wexA (A:)
    gssgssgshhkvsvspvvhvrglcesvveadlvealekfgticyvmmmpfkrqalvefen
    idsakecvtfaadvpvyiagqqaffnystskritrpgnsgpssg