PDB entry 1wen

View 1wen on RCSB PDB site
Description: Solution structure of PHD domain in ING1-like protein BAC25079
Class: DNA binding protein
Keywords: NMR, structural genomics, PHD domain, ING1-like protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inhibitor of growth family, member 4; ING1-like protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1110062A16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C0D7 (7-64)
      • cloning artifact (0-6)
      • cloning artifact (65-70)
    Domains in SCOPe 2.08: d1wena1, d1wena2, d1wena3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wenA (A:)
gssgssgdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcp
rcsqesgpssg