PDB entry 1wdm

View 1wdm on RCSB PDB site
Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native3)
Class: lyase,oxidoreductase/transferase
Keywords: alpha2beta2 heterotetrameric complex, LYASE, OXIDOREDUCTASE/TRANSFERASE COMPLEX, LYASE,OXIDOREDUCTASE/TRANSFERASE COMPLEX
Deposited on 2004-05-17, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.214
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty oxidation complex alpha subunit
    Species: Pseudomonas fragi [TaxId:296]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdma1, d1wdma2, d1wdma3, d1wdma4
  • Chain 'B':
    Compound: Fatty oxidation complex alpha subunit
    Species: Pseudomonas fragi [TaxId:296]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdmb1, d1wdmb2, d1wdmb3, d1wdmb4
  • Chain 'C':
    Compound: 3-ketoacyl-CoA thiolase
    Species: Pseudomonas fragi [TaxId:296]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdmc1, d1wdmc2
  • Chain 'D':
    Compound: 3-ketoacyl-CoA thiolase
    Species: Pseudomonas fragi [TaxId:296]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdmd1, d1wdmd2
  • Heterogens: ZN, ACO, NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdmA (A:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadkkgkq
    kklvdssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvy
    gigfplfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdmA (A:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyaykklvdssv
    levlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplfr
    ggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdmB (B:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadkkgkq
    kklvdssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvy
    gigfplfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdmB (B:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayekqkklvd
    ssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvygigfp
    lfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wdmC (C:)
    slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
    vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
    vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
    katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
    ssqitdgascmivmsaqrakdlgleplavirsmavagvdpaimgygpvpatqkalkragl
    nmadidfielneafaaqalpvlkdlkvldkmnekvnlhggaialghpfgcsgarisgtll
    nvmkqnggtfglstmciglgqgiatvferv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wdmD (D:)
    slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
    vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
    vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
    katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
    ssqitdgascmivmsaqrakdlgleplavirsmavagvdpaimgygpvpatqkalkragl
    nmadidfielneafaaqalpvlkdlkvldkmnekvnlhggaialghpfgcsgarisgtll
    nvmkqnggtfglstmciglgqgiatvferv