PDB entry 1wdl

View 1wdl on RCSB PDB site
Description:
Deposited on 2004-05-17, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.233
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wdlA (A:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadkkgkq
    kklvdssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvy
    gigfplfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdlB (B:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadkkgkq
    kklvdssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvy
    gigfplfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdlB (B:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayklvdssvl
    evlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplfrg
    galryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wdlC (C:)
    slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
    vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
    vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
    katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
    ssqitdgascmivmsaqrakdlgleplavirsmavagvdpaimgygpvpatqkalkragl
    nmadidfielneafaaqalpvlkdlkvldkmnekvnlhggaialghpfgcsgarisgtll
    nvmkqnggtfglstmciglgqgiatvferv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wdlD (D:)
    slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
    vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
    vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
    katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
    ssqitdgascmivmsaqrakdlgleplavirsmavagvdpaimgygpvpatqkalkragl
    nmadidfielneafaaqalpvlkdlkvldkmnekvnlhggaialghpfgcsgarisgtll
    nvmkqnggtfglstmciglgqgiatvferv