PDB entry 1wd8

View 1wd8 on RCSB PDB site
Description: Calcium free form of human peptidylarginine deiminase type4 (PAD4)
Class: Hydrolase
Keywords: Post-translational enzyme, Hydrolase
Deposited on 2004-05-12, released 2004-07-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-arginine deiminase type IV
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1wd8a1, d1wd8a2, d1wd8a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wd8A (A:)
    gplgspqmaqgtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdia
    hsppakkkstgsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallyltav
    eislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevld
    sedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpkw
    pshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv
    apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme
    igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs
    ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd
    eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk
    tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg
    khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhcgtnvrrkp
    fsfkwwnmvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wd8A (A:)
    aqgtlirvtpeqpthavcvlgtltqldicsssfsinaspgvvvdiahstwpldpgvevtl
    tmkaasgstgdqkvqisyygpktppvkallyltaveislcaditrtgkvkqrtwtwgpcg
    qgaillvncdrdldsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrk
    csvvlgpkwpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavv
    fqdsvvfrvapwimtpntqppqevyacslksvttlamkakcklticqdemeigyiqaphk
    tlpvvfdsdfgyvtrggldsfgnlevsppvtvrgkeyplgrilfgdscypsndsrqmhqa
    lqdflsaqqvqapvklysdwlsvghvdeflsfvpapdrkgfrlllasprscyklfqeqqn
    eghgeallfkqqkiknilsnktlrehnsfvercidwnrellkrelglaesdiidipqlfk
    lkefskaeaffpnmvnmlvlgkhlgipkpfgpvingrccleekvcslleplglqctfind
    cgtnvrrkpfsfkwwnmvp