PDB entry 1wcu

View 1wcu on RCSB PDB site
Description: cbm29_1, a family 29 carbohydrate binding module from piromyces equi
Class: carbohydrate binding
Keywords: carbohydrate binding, cbm29, cbm29_1, carbohydrate binding module
Deposited on 2004-11-22, released 2005-03-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.141
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-catalytic protein 1
    Species: PIROMYCES EQUI [TaxId:99929]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1WCU (143-End)
    • Uniprot Q9C171 (1-142)
    Domains in SCOPe 2.04: d1wcua_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wcuA (A:)
    mvsatysvvyetgkklnsgfdnwgwdskmsfkdnslvltadpdeygaislknlnsnyygk
    ggciylqvkteteglvkvqgvrgydeteafnvgsfrsssdfteykfevddeyqfdriivq
    dgpasnipiymryiiystgscddhilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcuA (A:)
    vsatysvvyetgkklnsgfdnwgwdskmsfkdnslvltadpdeygaislknlnsnyygkg
    gciylqvkteteglvkvqgvrgydeteafnvgsfrsssdfteykfevddeyqfdriivqd
    gpasnipiymryiiystgscddhilehhh