PDB entry 1wcs

View 1wcs on RCSB PDB site
Description: a mutant of trypanosoma rangeli sialidase displaying trans-sialidase activity
Class: hydrolase
Keywords: trans-sialidase, sialidase, trypanosoma cruzi, trypanosoma rangeli, protein engineering, hydrolase
Deposited on 2004-11-21, released 2004-12-15
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24805
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Trypanosoma rangeli
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44049 (2-2)
      • conflict see remark 9 (52)
      • engineered mutation (98)
      • engineered mutation (100)
      • engineered mutation (122)
      • conflict see remark 9 (179)
      • conflict see remark 9 (188)
      • engineered mutation (251)
      • engineered mutation (286)
      • conflict see remark 9 (374)
      • conflict see remark 9 (412)
      • conflict see remark 9 (608)
    • Uniprot O44049 (3-End)
    Domains in SCOP 1.73: d1wcsa1, d1wcsa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wcsA (A:)
    aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvvdptvivkgnklyilvgsfnkt
    rnywtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdynrrlvyessdmgktwvealgtlshvwtnsptsnqpdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpatppskgacgaavpt
    aglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryq
    fanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapaspt
    gswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgapt
    dsrvtvtnvvlynrrlnsseirtlflsqdmigtdggagtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcsA (A:)
    aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvvdptvivkgnklyilvgsfnkt
    rnywtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdynrrlvyessdmgktwvealgtlshvwtnsptsnqpdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpaacgaavptaglvgf
    lshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfanyrf
    tlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgswelh
    kkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgaptdsrvtv
    tnvvlynrrlnsseirtlflsqdmigtd