PDB entry 1wcg

View 1wcg on RCSB PDB site
Description: aphid myrosinase
Class: hydrolase
Keywords: aphid, beta-glucosidase, myrosinase, thioglucosidase, insect, glucosidase, beta-barrel, hydrolase, glycosidase
Deposited on 2004-11-15, released 2005-11-23
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-23, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.133
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioglucosidase
    Species: Brevicoryne brassicae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wcga1
  • Chain 'B':
    Compound: thioglucosidase
    Species: Brevicoryne brassicae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wcgb1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wcgA (A:)
    mdykfpkdfmfgtstasyqieggwnedgkgeniwdrlvhtspevikdgtngdiacdsyhk
    ykedvaiikdlnlkfyrfsiswariapsgvmnslepkgiayynnlinelikndiiplvtm
    yhwdlpqylqdlggwvnpimsdyfkeyarvlftyfgdrvkwwitfnepiavckgysikay
    apnlnlkttghylaghtqliahgkayrlyeemfkptqngkisisisgvffmpknaesddd
    ietaeranqfergwfghpvykgdyppimkkwvdqkskeeglpwsklpkftkdeikllkgt
    adfyalnhyssrlvtfgsdpnpnfnpdasyvtsvdeawlkpnetpyiipvpeglrklliw
    lkneygnpqllitengygddgqlddfekisylknylnatlqamyedkcnvigytvwslld
    nfewfygysihfglvkidfndpqrtrtkresytyfknvvstgkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcgA (A:)
    ykfpkdfmfgtstasyqieggwnedgkgeniwdrlvhtspevikdgtngdiacdsyhkyk
    edvaiikdlnlkfyrfsiswariapsgvmnslepkgiayynnlinelikndiiplvtmyh
    wdlpqylqdlggwvnpimsdyfkeyarvlftyfgdrvkwwitfnepiavckgysikayap
    nlnlkttghylaghtqliahgkayrlyeemfkptqngkisisisgvffmpknaesdddie
    taeranqfergwfghpvykgdyppimkkwvdqkskeeglpwsklpkftkdeikllkgtad
    fyalnhyssrlvtfgsdpnpnfnpdasyvtsvdeawlkpnetpyiipvpeglrklliwlk
    neygnpqllitengygddgqlddfekisylknylnatlqamyedkcnvigytvwslldnf
    ewfygysihfglvkidfndpqrtrtkresytyfknvvstgkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wcgB (B:)
    mdykfpkdfmfgtstasyqieggwnedgkgeniwdrlvhtspevikdgtngdiacdsyhk
    ykedvaiikdlnlkfyrfsiswariapsgvmnslepkgiayynnlinelikndiiplvtm
    yhwdlpqylqdlggwvnpimsdyfkeyarvlftyfgdrvkwwitfnepiavckgysikay
    apnlnlkttghylaghtqliahgkayrlyeemfkptqngkisisisgvffmpknaesddd
    ietaeranqfergwfghpvykgdyppimkkwvdqkskeeglpwsklpkftkdeikllkgt
    adfyalnhyssrlvtfgsdpnpnfnpdasyvtsvdeawlkpnetpyiipvpeglrklliw
    lkneygnpqllitengygddgqlddfekisylknylnatlqamyedkcnvigytvwslld
    nfewfygysihfglvkidfndpqrtrtkresytyfknvvstgkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcgB (B:)
    ykfpkdfmfgtstasyqieggwnedgkgeniwdrlvhtspevikdgtngdiacdsyhkyk
    edvaiikdlnlkfyrfsiswariapsgvmnslepkgiayynnlinelikndiiplvtmyh
    wdlpqylqdlggwvnpimsdyfkeyarvlftyfgdrvkwwitfnepiavckgysikayap
    nlnlkttghylaghtqliahgkayrlyeemfkptqngkisisisgvffmpknaesdddie
    taeranqfergwfghpvykgdyppimkkwvdqkskeeglpwsklpkftkdeikllkgtad
    fyalnhyssrlvtfgsdpnpnfnpdasyvtsvdeawlkpnetpyiipvpeglrklliwlk
    neygnpqllitengygddgqlddfekisylknylnatlqamyedkcnvigytvwslldnf
    ewfygysihfglvkidfndpqrtrtkresytyfknvvstgkp