PDB entry 1wbj

View 1wbj on RCSB PDB site
Description: wildtype tryptophan synthase complexed with glycerol phosphate
Class: lyase
Keywords: lyase, pyridoxal phosphate, tryptophan biosynthesis
Deposited on 2004-11-01, released 2006-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.18
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbja_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbjb_
  • Heterogens: G3P, PLP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wbjA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbjA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wbjB (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdilkargei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbjB (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdil