PDB entry 1wb0

View 1wb0 on RCSB PDB site
Description: specificity and affinity of natural product cyclopentapeptide inhibitor argifin against human chitinase
Class: hydrolase/hydrolase inhibitor
Keywords: cyclopentapeptide inhibitors, chitinase inhibitors, carbohydrate metabolism, chitin degradation, chitin-binding, glycosidase, hydrolase-hydrolase inhibitor complex
Deposited on 2004-10-29, released 2005-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.178
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitotriosidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wb0a1, d1wb0a2
  • Chain 'B':
    Compound: Argifin
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1WB0 (0-4)
  • Heterogens: IPA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wb0A (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqelslpylpsgtpelevpkpgqpsepehgpspgqdtfcqgkadglypnprerssfysca
    agrlfqqscptglvfsnsckcctwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb0A (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqels
    

  • Chain 'B':
    No sequence available.