PDB entry 1wax

View 1wax on RCSB PDB site
Description: protein tyrosine phosphatase 1b with active site inhibitor
Class: hydrolase
Keywords: acetylation, hydrolase, phosphorylation, protein tyrosine phosphatase, inhibitors
Deposited on 2004-10-28, released 2005-01-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1waxa_
  • Heterogens: MG, LO1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1waxA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1waxA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedl