PDB entry 1waw

View 1waw on RCSB PDB site
Description: specificity and affinity of natural product cyclopentapeptide inhibitor argadin against human chitinase
Class: hydrolase
Keywords: human chitinase, argadin, cyclopentapeptide inhibitors, chitinase inhibitors, hydrolase, glycosidase
Deposited on 2004-10-28, released 2005-01-28
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.174
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitotriosidase 1
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wawa1, d1wawa2
  • Heterogens: SO4, RIG, GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wawA (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqelslpylpsgtpelevpkpgqpsepehgpspgqdtfcqgkadglypnprerssfysca
    agrlfqqscptglvfsnsckcctwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wawA (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqelsl